- VGLL4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81543
- This antibody was developed against Recombinant Protein corresponding to amino acids: PISPSKRKFS MEPGDEDLDC DNDHVSKMSR IFNPHLNKTA NGDCRRDPRE RSRSPIERAV APTMSLHGSH LYTSLP
- 0.1 ml
- Western Blot, Immunocytochemistry/ Immunofluorescence
- PBS (pH 7.2) and 40% Glycerol
- VGLL4
- Rabbit
- Unconjugated
- Human
- VGL-4
- vestigial like family member 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
Specifications/Features
Available conjugates: Unconjugated